SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X6W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X6W8
Domain Number 1 Region: 67-198
Classification Level Classification E-value
Superfamily FKBP-like 1.91e-38
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 2 Region: 177-292
Classification Level Classification E-value
Superfamily FKBP-like 8.05e-37
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 
Domain Number 3 Region: 292-403
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-31
Family FKBP immunophilin/proline isomerase 0.0004
Further Details:      
 
Domain Number 4 Region: 3-78
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-23
Family FKBP immunophilin/proline isomerase 0.00083
Further Details:      
 
Domain Number 5 Region: 422-487
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000321
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G3X6W8
Sequence length 501
Comment (tr|G3X6W8|G3X6W8_BOVIN) Peptidylprolyl isomerase {ECO:0000256|PROSITE-ProRule:PRU00277} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=FKBP10 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
SYDRHTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGVSGLIPPDATLY
FDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDSDFVRYHYNGTLLDGTAFDTSYSKGGTY
DTYVGSGWLIKGMDQGLLGMCPGERRKIVIPPFLAYGEKGYGTVIPSQASLVFHVLLIDV
HNPKDTVQLETLELPPGCVRRAVAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYVGQGY
IIPGMDQGLQGSCMGERRRITIPPHLAYGENGTGDKIPGSAVLIFDVHVIDFHNPADPVE
IKTLSRPLETCNETAKLGDFVHYHYNCSLLDGTRLFSSHDYGAPQEATLGAHKVIEGLDT
GLQGMCVGERRQLVVPPHLAHGESGARGVPGSAVLLFEVELVSREDGLPTGYLFVWHEDP
PAHLFEHMDLNKDGEVPVEEFSTFIKAQVSEGKGRLLPGQDPEKTIGDMFQNQDRNQDGK
ITAEELKLKSDEDQDRVHEEL
Download sequence
Identical sequences G3X6W8
ENSBTAP00000015220 ENSBTAP00000015220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]