SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G3X7P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G3X7P6
Domain Number 1 Region: 73-135,172-237
Classification Level Classification E-value
Superfamily EF-hand 5.75e-22
Family Calmodulin-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G3X7P6
Sequence length 362
Comment (tr|G3X7P6|G3X7P6_BOVIN) EF-hand calcium binding domain 6 {ECO:0000313|Ensembl:ENSBTAP00000040233} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=EFCAB6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MCKMAVVPDWHIICPYTRKFTHSRPHSSPCRVYSRSVFQNMFRPSSSTTVANPILSSLDV
KRILFQKITEKGDELKRAFHLLDTANNMTVTKSELRRVITTFLLPLTREQFQDVLAQIPL
TSSGAVPYLVFLSRFGGIDLNINVIKRGGENEMNGCRTLKDLEAQVGEKIFKNIKTVIKA
LMLIDVNTTGLVQPHELRRVLETFCLKMKDEEYKKFAQHYNIDKDAAVDYNVFLKNLGSN
NDLNLKYNMGSQEVLWENQRVKSFKREEPPSSAVSDNIWKNYSLDEIETAFCLELSKCYE
KVEKALSAGDPCTSGYVSLNYLKIVLDTFVYRLPRRIFIQLMKSLLYKIDLLKTKPVFKY
EE
Download sequence
Identical sequences G3X7P6
ENSBTAP00000040233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]