SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4M0I1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4M0I1
Domain Number 1 Region: 777-1038
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.7e-58
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 36-489,674-746
Classification Level Classification E-value
Superfamily ARM repeat 3.12e-52
Family HEAT repeat 0.00000462
Further Details:      
 
Domain Number 3 Region: 1014-1082,1126-1151
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000448
Family Ankyrin repeat 0.0054
Further Details:      
 
Domain Number 4 Region: 1216-1258
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000157
Family SOCS box-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G4M0I1
Sequence length 1291
Comment (tr|G4M0I1|G4M0I1_SCHMA) Ankyrin repeat-containing, putative {ECO:0000313|EMBL:CCD60649.1} KW=Complete proteome; Reference proteome OX=6183 OS=Schistosoma mansoni (Blood fluke). GN=Smp_166010 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MSVLEAVLQTLKTLRFDNSTASSNTSDAEYENLEASEKLRVFHTLPTLASSLGPVDTREK
LIPTISDVVSNAIDAGDDEILMVIAQKLGSFGDLVGGAEHIPLIVPILANIIYSIEEVVV
AEAACNSLIALLPKLPNDVVDSTFAPIIRHIIEEDLYCASRKVVTKLIIACYPMVSARNQ
VDFKYRLFHLADSEDEVPLVRAAAVQQLVPLAKLFGPELKSELGLLLASLVSDNQRVVRA
ACLPPLVELGRMITDAAEFDSTVRPCIDKLAGDPSRDVRRAMASVITNLQTLVCNHGGAS
RSLHQTMLNLLEDNEVETRRISAGQLKDFCLASPKDILVTVLLPRLREHLSMEREERVRS
ELVRCAVGLLPSIRREDCLPLVQHILGFLNDTSSQSKQYVFEHFSELVALMPANEIQLTL
LPSLLRLWQDKNWRVRLGVVQSVPCLYDKLPENCLQETVLPANLAWLRDPAWCVRECACR
SLARLLVACPGACKKAFSGVGSKPSTNSGSGSVTSNPNSASSNVTNPTSGTNASNTSTGN
LPSSTNAQVLDQANTSGLSTLSSTTSNTSAVNPANALTTQAAAGGLKALAVDTNYHLRQI
YINVVQAVWGPGILDEPPYSALGDDPSAGILFPASRNIYAYLSSKTSKNPTNSDNSNVTT
VPKGCQAPPQIPNVYLTGCVAQLLRFLSEDVVPNVRICATQALHVISGSLDKKTIQNDVI
PVLKKVIDYDFDQDVRFFAQQSLNWIIVLDVISFNGKFGKLYIMTSSSSTTIPGLAFYDS
LINNNITESKRLVELHKIDINARLSHVRKRNHTDLCPVHLVAYKGNLAMLHYLIQNGVNV
HQPTCTLQRRPVHYAALRQQVSCLQMLLNAGAQIDARDTFGNTPLHYAAEDGDGGLLSLL
LNNGACVDAQDITNKTPLMKAARSGKVWAVRRLLLFGANVNVKDRNDETALHYACRQGST
EITRMLIKAESRLNAQNQIGLTPLMESVSYNQREAVSLLIKHKDIDLYKRDFCTGDTALH
IAVKKNYIHIVEILLRAGNWYIEYNYNNLGESFVHDVVAYNRLELLRLFLAYNYDLDRPA
KRLPPNIHLLTSSLNHSIISKTTQTTITPSMIQSESNSRAVINPFEKSPFKMALERGHLD
MARILAEVGCFCTHLPIHSNSISSVCASSSSSSSTSASSSSSGNNVTDTNTIHSTMKNSH
LIHQNLLTRRYNGLLEVKSLQKWCRKVIRQHLGFRLIESLPLLPIPVSLKDFLLLRDIDW
SIYLNGNNHNHNNTNRSSIINSGELAIIVPT
Download sequence
Identical sequences G4M0I1
XP_018646998.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]