SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4MQV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4MQV7
Domain Number 1 Region: 27-232
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.19e-36
Family Cutinase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G4MQV7
Sequence length 233
Comment (tr|G4MQV7|G4MQV7_MAGO7) Cutinase {ECO:0000256|RuleBase:RU361263} KW=Complete proteome; Reference proteome OX=242507 OS=blast fungus) (Pyricularia oryzae). GN=MGG_11091 OC=Magnaporthe.
Sequence
MLFPSALLLAAPLVLAAPAALEERQAPCQDVHVFLARGTSEPYPGRQELTVNAICKGISS
CGFEDIQYPAAFNPTYCASVDQGVSNGISQVTAYASRCPNSKLVLSGYSQGAHVVGDILG
GGGGSFQGCTQRTVQGLNPTTSPGNKIKAALLWGDVRHTANQAYNTNTGASRPGTWPRSG
SQLTSLNRFSSVLRAICVSTDPVCAGGQDGNSHTTYFNLFSEDAAAWVKTKLN
Download sequence
Identical sequences G4MQV7 L7JDW7
MGG_11091T0 XP_003710800.1.18062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]