SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4QJN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4QJN5
Domain Number 1 Region: 39-110
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000068
Family Coronavirus S2 glycoprotein 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4QJN5
Sequence length 220
Comment (tr|G4QJN5|G4QJN5_GLANF) Glutamine synthetase {ECO:0000313|EMBL:AEP28695.1} KW=Complete proteome; Reference proteome OX=1085623 OS=Glaciecola nitratireducens (strain JCM 12485 / KCTC 12276 / FR1064). GN=GNIT_0541 OC=Alteromonadaceae; Glaciecola.
Sequence
MPRFFVLRSLFCLCFLSLTACQSAVDGAYYGMWEKLGVEKRDILVDRVEDAQDSQKDAQE
QFASALDEFSSLINFDGGELEDIYNNLSDQLEASKESAASVTRRIDKVEGVANALFVEWE
AEIDMISSANLQRDSKRKLAETRRKYATLLVSMRKVEKSMAPVLVALQDNVFALKHNLNA
EAIGALQGEFNSIKQDVSSLIKEMNVAIAQSDDFIKSIRN
Download sequence
Identical sequences G4QJN5
gi|348028002|ref|YP_004870688.1| WP_014107572.1.47640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]