SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4UF75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4UF75
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-28
Family Thioltransferase 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4UF75
Sequence length 109
Comment (tr|G4UF75|G4UF75_NEUT9) Putative glutaredoxin {ECO:0000313|EMBL:EGZ75149.1} KW=Complete proteome; Reference proteome OX=510952 OS=Neurospora tetrasperma (strain FGSC 2509 / P0656). GN=NEUTE2DRAFT_120216 OC=Neurospora.
Sequence
MSDAATQKAKQLINDNAVVVFSKSYCPYCSNTKQILDGLNAKYATYELNQESDGSDVQDA
LLKLTGQRTVPNIFIGKQHIGGNSDLEAVVKNGKNGKKIQELLQEAGAL
Download sequence
Identical sequences F8MET5 G4UF75 Q9P718
jgi|Neute1|179994|fgenesh2_kg.42__7__524_1_CCGZ 5141.NCU01219.1 XP_009848044.1.73169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]