SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4URP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4URP8
Domain Number 1 Region: 9-219
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.19e-66
Family Glutathione peroxidase-like 0.00000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4URP8
Sequence length 225
Comment (tr|G4URP8|G4URP8_NEUT9) Mitochondrial peroxiredoxin PRX1 {ECO:0000313|EMBL:EGZ71138.1} KW=Complete proteome; Reference proteome OX=510952 OS=Neurospora tetrasperma (strain FGSC 2509 / P0656). GN=NEUTE2DRAFT_146061 OC=Neurospora.
Sequence
MASTDRNAPLRLGTIAPNFQADTTTGPIDFHEFIGDNWVILFSHPEDYTPVCTTELGEMA
RLEPEFKKRGVKLIGLSANTLGSHEGWINDIKDVTGSQVQFPIIADKERKVAYLYDMLDY
QDTTNVDEKGIAFTIRSVFVIDPKKTIRTILAYPASTGRNSAEILRIVDSLQTGDKHKVT
TPINWVPGDDVIVHPSIKGEEATRLFPNLKAVKPYLRFTPLPKDA
Download sequence
Identical sequences A0A0B0E311 F8MXV4 G4URP8 Q7S4F4
jgi|Neute1|190026|estExt_fgenesh2_kg.C_160007 NCU06031T0 5141.NCU06031.1 XP_009854856.1.73169 XP_959621.1.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]