SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4V6D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4V6D7
Domain Number 1 Region: 135-315
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.7e-22
Family UAS domain 0.019
Further Details:      
 
Domain Number 2 Region: 363-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000269
Family UBX domain 0.021
Further Details:      
 
Weak hits

Sequence:  G4V6D7
Domain Number - Region: 19-55
Classification Level Classification E-value
Superfamily UBA-like 0.0289
Family TS-N domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G4V6D7
Sequence length 513
Comment (tr|G4V6D7|G4V6D7_SCHMA) Fas-associated factor-related {ECO:0000313|EMBL:CCD75745.1} KW=Complete proteome; Reference proteome OX=6183 OS=Schistosoma mansoni (Blood fluke). GN=Smp_084610 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MLDNDNVDEAHALSESEAQDVQHLREIAGGIGYLDALKLLEESSWDLERAVHKLMGFEDS
SLRQRSTASRASSVPQVELVPPNQRILRSRNSTHSWLWSTALFLLEPIRMGCSFFFGIVK
FFASFLWSDPRNQVTDPAGDVRKFIQHFKETYGPVNTSFDVDGNSNPTENSTSDSFPPFF
EGTYADAVQEAKQSLRFLIVYLHGDSHEDTHRFCKDILQSEDVLRFLRNSNELLFWGCNI
ESPEGYRVSRTLREHTYPFIGVIGLTNMPISESGIYTGSSTRMALLGRIEGVLESSELVN
QLNSILNEHQTAIITARLDRSEREMNAQLRREQDLAYEASLAEDRAKMAAREAQQRSAAL
EAEQLAKDAKRKEDLQKAHINRKRIWKNRLPPPPKFEEGSTVQLSFKMPHGSRVSRVFNL
NDSIKLLYYFILSQDDSPTEFEVQSNFPKRIIPCQPFEESDVEDYVNTPDNKMDCDEPEV
ITDWSPKCQNDPPSFFDIDLTRPEMLFVLNKDA
Download sequence
Identical sequences G4V6D7
Smp_084610 XP_018648619.1.29077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]