SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4VAK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4VAK5
Domain Number 1 Region: 116-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 87-115
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000327
Family Somatomedin B domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G4VAK5
Sequence length 398
Comment (tr|G4VAK5|G4VAK5_SCHMA) Uncharacterized protein {ECO:0000313|EMBL:CCD75481.1} KW=Complete proteome; Reference proteome OX=6183 OS=Schistosoma mansoni (Blood fluke). GN=Smp_060030 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MIRSIQKRFNIQFNSKFLHWVTLFSFYITINQISLVISNGCLQPNGMSICCAGREEKCFV
YKSTGQSSISRYYPWRKYRSVAGHSSPRGRCFCDESCVITGDCCHDYQFTCQKTKVDCTV
SEWGPWTSCEYACGQSVSTRYRQVQIKPSNNGKPCPELNETRPCIGHNCASKRFGRSGTL
MVPYVYDIKAEVAHLLPVRGDVLDLTRRYDMRFDVRRKLYLGRLIKMNKTEQPEPDPYCA
VYEITYTNQACQTQNLLWQFSSSRDQYPYYYYPNRYKRHNGYNGQSITFSRKSFLHERQY
NKLGNTGLNKNWEDDYSNSESWITHSALLTPGQQICVTCYPTYMREDLGYRCTGSGLPNI
ETRWRALRTSDCQGRFRMVSIPQRSCTCGRGVASFVFV
Download sequence
Identical sequences G4VAK5
XP_018648356.1.29077 Smp_060030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]