SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G4YZI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G4YZI6
Domain Number 1 Region: 19-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.89e-47
Family PAPS reductase-like 0.0000452
Further Details:      
 
Domain Number 2 Region: 274-346
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000183
Family Thioltransferase 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G4YZI6
Sequence length 355
Comment (tr|G4YZI6|G4YZI6_PHYSP) Uncharacterized protein {ECO:0000313|EMBL:EGZ25192.1} KW=Complete proteome; Reference proteome OX=1094619 OS=(Phytophthora megasperma f. sp. glycines). GN=PHYSODRAFT_326255 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAAPVFDESQFASLEAYAEALNAQLEGKSATEIVEWTFDTFGARTVLSSSFGIQSAVMLH
LTRSVSRSITVVWVDTGYLPKETYQFAARLTKALDLDVRVYQSPITPARMEALYGKLYEL
ETPEAHRQYGFMRKVEPMQRALKELDAAALLVGVRADQTQHRQHMKHVNVYEGRLKICPI
LNWSKHEVDQYMAVNQLEYHPLKAQGYESVGDAHSSRPVTEADKGNDRAGRFNGKQQECG
LHLDMHDMKLEDLKFDDPLALSENDQKLLELTKRAKGITVFTKPTCKYCLAAKDVMRERE
WEFDEVSVPTEVSIQSLQQIVGKPVKTVPQIFLDGKYIGGYTEFVAHLGIPSRFA
Download sequence
Identical sequences G4YZI6
XP_009520480.1.77131 jgi|Physo1_1|156997|C_scaffold_32000048 67593.JGI156997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]