SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AKM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AKM3
Domain Number 1 Region: 65-191
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.46e-22
Family DnaQ-like 3'-5' exonuclease 0.0000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AKM3
Sequence length 225
Comment (tr|G5AKM3|G5AKM3_HETGA) Apoptosis-enhancing nuclease {ECO:0000313|EMBL:EHA97583.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_21284 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAWMALLQEQGLLNMLPESGSLPSEALPGSEAASGERQRPRAGSGDGGQGRRPAPRKASG
PSSSKFVAIDCEMVGMGPRGCVSELACCSVVSYHGDILYDKYIRPEMPIVDYRTRWSGIT
RQHMHKAIPFQVVQKEILNLLKGKPDLHTRGRVSLKDLALQLLHKRIQVGQHGHSSVEDA
ATVMELYQLVEDRWEQEAASSLWSHPENREPNSSTDMEHYMEDQY
Download sequence
Identical sequences G5AKM3
HGL_H00000368533-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]