SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5ALM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ALM9
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-31
Family Rhodopsin-like 0.0093
Further Details:      
 
Domain Number 2 Region: 346-481
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000358
Family FAD-linked reductases, N-terminal domain 0.0000922
Further Details:      
 
Domain Number 3 Region: 241-318
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000466
Family FAD-linked reductases, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5ALM9
Sequence length 489
Comment (tr|G5ALM9|G5ALM9_HETGA) Olfactory receptor 2L2 {ECO:0000313|EMBL:EHA97939.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16495 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MALAGKLTMVLFILLDAQHRTLMYFMLSQLSLMDLIYNCTTVPKKASGFLFGNKSISFIG
CEVQGFFFAMLASSEGPILRSMAYDCYMAICFPLHYPICMNRRVCVLMILGSWAMASVNS
CAHIVYIFCIPYCSRGQGGGCFCTILTPMLNPVIYNLRNKEVQGALGRVTEKFHSTKMSH
DAKHGSAKLAPCGMQAAVGAWHSSPELSTELSEDRPTQGAGLVLIHLAVHQGPSLPGDFK
RVMVLEAKGNVGGRIEAHCISRSDWYIELGSMRFHVIHRMSSEFIQKSGLKLMEFCSCDN
HSWVLVNRVLQHLGAVQANPDLLGYLVRAHEARKMTEQLFNQSLMKVMVLEAKGNVGGRI
EAHCISRSDWYIELGSMRFHVIHRMSSEFIQKSGLKLMEFCSCDNHSWVLVNRVLQHLGA
VQANPDLLGYLVRAHEARKMTEQLFNQSLMKVEEELKGSSCLHMLEKFDSFSTKEYLVKV
GNLSHGVCR
Download sequence
Identical sequences G5ALM9
HGL_H00000347428-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]