SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AM20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G5AM20
Domain Number - Region: 70-88
Classification Level Classification E-value
Superfamily SH3-domain 0.022
Family SH3-domain 0.0057
Further Details:      
 
Domain Number - Region: 35-96
Classification Level Classification E-value
Superfamily Subunit III of photosystem I reaction centre, PsaF 0.0327
Family Subunit III of photosystem I reaction centre, PsaF 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AM20
Sequence length 251
Comment (tr|G5AM20|G5AM20_HETGA) Uncharacterized protein {ECO:0000313|EMBL:EHA98080.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16281 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MPHSATPLLKNIIIRSQFDSIRRKQCLQYLKTLKSLRYDGFQTVYLGETDIPESLVTGED
FGNGYFLPTPTWCMVHAGGSQGWVPWNYQMFLRDELCTKQEDKLFFEFCDVVKKAYGKCA
IVVKGRRQENETKPKEDGEAEVQFYVPPVINLSSIVCCPEVAKFYGHELLSLPSPYNYLN
PLDSAWSSLKWFIINNRKGFCLQSTDNVYSYQYILFSDLISKGIERINLSKWKTIVKKVQ
RWENYYLGKFS
Download sequence
Identical sequences G5AM20
HGL_M00000049694 XP_004842395.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]