SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AM84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AM84
Domain Number 1 Region: 136-313
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 9.94e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0057
Further Details:      
 
Domain Number 2 Region: 86-130
Classification Level Classification E-value
Superfamily TGS-like 0.0000621
Family TGS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AM84
Sequence length 323
Comment (tr|G5AM84|G5AM84_HETGA) 39S ribosomal protein L39, mitochondrial {ECO:0000313|EMBL:EHA98144.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_00852 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
IEAMASAVRGLRLWLVAPSGGVSRRFIASSPAAQLSLTELTEMRNDLFNKEKKRQLSLTP
RTEKIEVKHVGKTDPGTVFVMNKNISTPYSCAMHLSEWYCRKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDCNPTEVNKAYWRSCAMMVGCVIERAFKDEYVVTLLRAPEVPVIAGAFC
YDVVLDKRLDEWIPTKENLRSLTKDAHGLIYKDLPFETLEVEAKVALEIFQHNKYKIDFI
EEKASQNPERTVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTQPCLVRRFQGL
SLPVHLKAHFTVWDKLLERSRKM
Download sequence
Identical sequences G5AM84
HGL_H00000305682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]