SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AMI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AMI3
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-17
Family SH3-domain 0.0000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AMI3
Sequence length 684
Comment (tr|G5AMI3|G5AMI3_HETGA) Dynein heavy chain 11, axonemal {ECO:0000313|EMBL:EHA98243.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_10765 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MARILLLFLPGLVAVCAGHGVFMDRLASKKLCADDECVYTISLARAQEDYNAPDCRFINV
KKGQQIYVYSKLVKENEAGEFWAGSVYGDHQTEMGIVGYFPSSLVKEQRVYQEATKEVLT
TAVALMEEFQGLDRDIEGSAKQWRKWVESECPEKEKLPQEWKKKNLIQKLIILRAVRPDR
MTYALRNFVEEKLGAKYVERTRLDLGKALEESSPATPVFFILSPGVDALKDLEMLGKRLG
FTIDSGKFYNVSLGQGQEKVAETALEKASRRGHWVILQNVHLVAKWLGTLEKLLEGFSQG
SHEDFRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFNQDTLEIC
TKEQEFKSILFSLCYFHACVAGRLRFGSQGWSRSYPFNPGDLTICANVLYNYLEANPNVP
WEDLRYLFGEIMYGGHITDVWDRRLCQVYLEEFMNPSLIEDELMLAPGFAAPPYLDYSGY
HQYIEEMLPPESPALLVLEDIHFTKKHFYFFSYLRLTRFNDLLLRCRELDTWTQDLVLPA
VVWLSGFFNPQSFLTAIMQSMARKNEWPLDRMCLTVDVTKKVKEDYSHPPREGAYLHGLS
MEGARWDIQSGTIVQARLKELTSTMPVIFAKAIPMDRQETRQTYECPVYKNKMRGSTYIW
TFRLKSKEKTAKWVLAGVALLLEA
Download sequence
Identical sequences G5AMI3
HGL_M00000062995-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]