SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AQ92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AQ92
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.31e-33
Family Chaperone J-domain 0.00018
Further Details:      
 
Domain Number 2 Region: 106-179
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000863
Family HSP40/DnaJ peptide-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AQ92
Sequence length 246
Comment (tr|G5AQ92|G5AQ92_HETGA) DnaJ-like protein subfamily A member 1 {ECO:0000313|EMBL:EHA99202.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18090 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVKETTYYDVLGVKSNATQEELKKAYRKLALKYHPDKNSNEGEKFKQISQIYEVLSDAKK
RELYDKEGEQAIKEGGAGGGFGSPMDIFDMFFRGGGRMQRERRGKNVVHQLSVTLEDLHN
GATRKLALQKNMICDKCESPGGQIVKRGDIKCVLNEGMPIYHRPYESCLILEFKVNFPEN
GFLSPDKFSLLEKLLHKTKEVEETDEMDPVELVDFDPNQERRRHYNGEAYADDEHHPRGG
VQCQTS
Download sequence
Identical sequences G5AQ92
HGL_H00000369127-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]