SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AS68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AS68
Domain Number 1 Region: 591-939
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.07e-111
Family PDEase 0.00000229
Further Details:      
 
Domain Number 2 Region: 407-586
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-48
Family GAF domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 234-417
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-34
Family GAF domain 0.0000000141
Further Details:      
 
Domain Number 4 Region: 40-205
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000023
Family GAF domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AS68
Sequence length 951
Comment (tr|G5AS68|G5AS68_HETGA) Phosphodiesterase {ECO:0000256|RuleBase:RU363067} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02116 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MVLVLHHILIAVVQFLRRGQQVFLKPDEPPPPPPPQPCADNLQDALLTLGSVIDIVGLRQ
AAKEALSAVLPRVETVYTYLLDGESRLETVYTYLLDGESRLVCEDPDHELPQEGKVREAV
ISQKRLSCNGLGPSDLLGKPLARMVAPLAPDTQVLVIPLVDKEAGVVAAVILVHCGQLSD
SEGQSLQAVEKHTLVALRRVQALQQRGSGAGPGAIQKPPAEAAEDQKGGEEHTDQDRKIL
QLCGELYDLDATLLQLKVLQYLQQETQATRCCLLLVSEDNLQLSCKVIGDKVLGEEISFP
LTMGRLGQVVEDKKSIQLKDLTSEDVQQLHNMLGCELQTMLCVPVISRATDQVVALACAF
NKLGGDLFTGQDEHVIQHCFHYTGTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDV
SVLLQEIITEARNLSNAEICSVFLLDQNELVAKVFDGGVVDDESYEIRIPADQGIAGHVA
TTGQILNIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFS
KFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGI
QPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGY
RDPPYHNWMHAFSVSHFCYLLYKNLELANYLEDIEIFALFVSCMCHDLDHRGTNNSFQVA
SKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDL
AHHLRIFKDLQKMAEVGYDRTNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEF
FSQGDLEKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVAS
NREHWTKVSHKFTIRGLPSNNSLDFLDEEYEVPELGGTRGPINGCCSLDAE
Download sequence
Identical sequences G5AS68
HGL_H00000401006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]