SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5ASD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5ASD8
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.55e-23
Family Translational machinery components 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5ASD8
Sequence length 105
Comment (tr|G5ASD8|G5ASD8_HETGA) 40S ribosomal protein S16 {ECO:0000313|EMBL:EHA99948.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_01908 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MIEPRTPQYKLLEPVLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALAAYYQKYVD
EASKKEIKDILIRYDRTLLVAEPRRCESKKFGDPGARAPYQKSNR
Download sequence
Identical sequences G5ASD8
HGL_H00000367806-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]