SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AT10 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AT10
Domain Number 1 Region: 27-138,188-276
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000125
Family DNA gyrase/MutL, N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AT10
Sequence length 1017
Comment (tr|G5AT10|G5AT10_HETGA) MORC family CW-type zinc finger protein 2 {ECO:0000313|EMBL:EHB00171.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_21091 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAFPYYSSLKRAQLTFEYLHTNSITHEFLFGALAELVDNARDADATRIDIYAERREDLQG
GFMLCFLDDGAGXDTANVIQFGKLAKRTPASTQIGQYGNGLKSGSMRIGKDFILFTKKED
TMTCLFLSCTFHEEEGIDEVIVPLPTWNAQTWEPITENMEKFSIERELIYKYSPFHTEEE
VMSQFMKIPGDSGTLVIIFNLKLMDNGEPELDIISNPRDIQMAETSPKGTKPERQSFRAY
AAVLYIDPRMKIFIHGHKVQTKRLTWCLYKPRMYKYTSSHFKTRAEQEVKKAERVAWIAE
EKACEAESKARTLEVQIGGNIMQDSKVMLRKVQNIAINLRREADIKKRIKEAKQRALKEP
KELNFVFGVNIEHRDLDGIFIYNCSRLIKMYEKVGPQLEGGMACGGVVGVVDVPYLVLDP
THNKQDFADAKEYRLLLRAMGEHLAQYWKDIAIAQRGITRFWDEFGYLSANWSQAPSNEL
QYKRRRAMAIPTTIQCDLCLKWRTLPFQLNSVGKDYPDTWVCSMNPDPEQDRCEALEQNQ
KLPLGTYKKDPKTQEQKKKQLSEKIRQQQKKLEALQKTTPIHSQAHVKKLPLEVIARSSS
TEEPGWSPKRPWSPPLPAVIRMNAPNRPSSLTDPRTVTKPRKAPVISSHPKLPTLAAWVE
PGTSRPLQSPEAPQKAMDIPIKTALVQPLSSSLRPNSKSSWEVPEPKVIKTVVVKKSEPA
DRLFRATTDRKRSLLVSEEAGRRKERCKCGRFAVKQEKKKSNEFSDSAVKQDLADLKRDQ
EDIGLHVEVHVNREWYPGCVTATAVGKNVVWWKVKFDHVSKDATPGNLWVEKGSDDVRLI
KPPFLEHQPPTAQVQDAEEKKAVVAQQAVAMPEPSIPDCVLIKPDTVALSTKCETIDLLA
QILRDCLQYFWPPNFPISKEELSTMNLDKLISFPLEEYFRQYEVHLQNLCCSYQNRANSQ
ARAFEECLCVSEKKLQEAQEKLQKLRTNIMVFLRKDADFNTGDELDAYIEHLVTKGD
Download sequence
Identical sequences G5AT10
HGL_H00000380763-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]