SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AU67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AU67
Domain Number 1 Region: 298-368
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.93e-17
Family SAM (sterile alpha motif) domain 0.00023
Further Details:      
 
Domain Number 2 Region: 217-319
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000263
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AU67
Sequence length 431
Comment (tr|G5AU67|G5AU67_HETGA) SAM and SH3 domain-containing protein 3 {ECO:0000313|EMBL:EHB00578.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03328 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLRRKPSNASEKEPTQKKKKPSFQKGKAASFPDLEAITQRHHCSDSCHGQLRRYEGKFFL
SVRCGYDMKQLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVPTPEDVGKSG
KKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTLEEGSASPTSPDCSLDSPGPEKMALA
FAEQEEHALPVLSRQASTGSELYSPSTGSGSFGEESPAPLYIGPFCGRARVHTDFTPSPY
DHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKLGSFKFIYVDVLPEEAVGPARPSRRQSKG
KRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNITDPQHRAKLLTA
AELLLDYDTGSEEAEEGAESSHEPVVHTVSEPKVDIPRDSGCFEGSESGRDEVELAGTEE
QLQGLSLAGVP
Download sequence
Identical sequences G5AU67
HGL_H00000394490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]