SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5AXN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AXN5
Domain Number 1 Region: 277-351
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.48e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 139-225
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.12e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 52-125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.51e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000896
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AXN5
Sequence length 443
Comment (tr|G5AXN5|G5AXN5_HETGA) Poly(RC)-binding protein 4 {ECO:0000313|EMBL:EHB01796.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_07756 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTLDKLIALSKQDPCSLARASQATAWTHSQATVAPAPPDRMSSSDAGLEEEPELSITLTL
RMLMHGKEVGSIIGKKGETVKRIREQSSARITISEGSCPERITTITGSTAAVFHAVSMIA
FKLDEDLCAAPANGGSVSRPPVTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGD
LLPNSTERAVTVSGVPDAIILCVRQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFS
VQGQYGAVTPAEVTKLQQLSGHAVPFASPSVVPGLDPSAQTSSQEFLVPNDLIGCVIGRQ
GSKISEIRQMSGAHIKIGNQAEGAGERHVTITGSPVSIALAQYLITACLETAKSTSGGTP
GSAPADLPAPFSPPLTALPTAPPGLLGTPYAISLSNFIGLKPVPFLALPPASPGPPPGLA
AYTAKMAAANGSKKAERQKFSPY
Download sequence
Identical sequences G5AXN5
HGL_H00000385335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]