SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AYW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AYW6
Domain Number 1 Region: 342-379
Classification Level Classification E-value
Superfamily SAP domain 0.000000000293
Family SAP domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5AYW6
Sequence length 902
Comment (tr|G5AYW6|G5AYW6_HETGA) MKL/myocardin-like protein 1 {ECO:0000313|EMBL:EHB02236.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02613 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
LKSPAAFHEQRRSLERARTEDYLKRKIRSRPERAELVRMHILEETSAEPSLQAKQLKLKR
ARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKVADSSSFDEDSSDAL
SPEQPASHESQGSVPSPLEARISEPLPSATSVSPSQVLSQLPLGPDSGETLFVAEQPPLP
PPPLLPPSLTNGTAIPTAKPAPTLIKQSQPKSAGEKAQRSKKAKELKPKVKKLKYHQYIP
PDQKQDKGAPTMDSSYARILQQQQLFLQLQILNQQQQQHYNYQTILPAPPKTAGEALGSS
GAPPVRSLSATNGCTSSSAPGPGGLARQNSAPLSGKPGALPANLDDMKVAELKQELKLRS
LPVSGTKTELIERLRTYQDQVGPVPGAPKAPTAPSLLSKAGEVVVAFPAARLSTGPALVT
AGLAPAEVVVATVTSNGVVKFGSTGSTPPVSPTPSERSLLSTGDENSTPGDAFGETVTSP
LTQLTLQASPLQVLVKEEGAAREPEGLDKDQMLQEKDRQIEALTRMLRXXXXXXVELLRL
QLEREKRAQQPGAPVKQEGGLPSCPLSHQPPAAARPFSPGLSVPAANHGDARAVAVKQEA
APEPEPMPGTQLLLGSQASSLLQGVTPPTLVTDATGTHLVLTVTNKNTDSPGLPGGSPLQ
ALSQPGSPAPGPPAQMDLEHPSQTPFGTPASLLKKEPPGYKEAVTQQPKQENGSSSQQMD
DLFDILIQSGEISVDFKEPPSLPGKEKPPSAAACGSPLAAQPLPAAELPQAAPPAPGSPV
LPGRLEDFLESSTGLPLLTGGHEGPEPLSLIDDLHSQMLSSSAILDHPPSPMDTSELHFA
PEPNSGVGLDLADGHLDSMDWLELSSGGPVLSLAPLSTAAPSLFSTDFLDGHDLQLHWDS
CL
Download sequence
Identical sequences G5AYW6
HGL_H00000379861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]