SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5AZN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5AZN8
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.68e-64
Family N-terminal domain of xrcc1 0.000000124
Further Details:      
 
Domain Number 2 Region: 533-623
Classification Level Classification E-value
Superfamily BRCT domain 2.36e-22
Family DNA-repair protein XRCC1 0.00000726
Further Details:      
 
Domain Number 3 Region: 314-398
Classification Level Classification E-value
Superfamily BRCT domain 4.97e-22
Family BRCT domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5AZN8
Sequence length 627
Comment (tr|G5AZN8|G5AZN8_HETGA) DNA repair protein XRCC1 {ECO:0000313|EMBL:EHB02499.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15406 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKSISVVLQLEKEEQIHSVDI
GNNGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRIFGPDKLVRTA
AEKHWDRIKIVCSQPYSKDSPYGLSFIRLHSPPDKEEAEVPSQKVTVTKLGQFRVKEEDE
SASSLRPGALFFGRINKTSPAKASDPAGPSYAAATLQASTSPLSKAVGSTTKPQESTKGK
RKLDLNVEERKIPSKPSAQLSPPALKRPKLPAPTRNPAAAPVPATAQRAVPRKPRGEGTE
PRGAQAGPQELGKILQGVVVVLSGFQNPFRSDLRDKALELGAKYRPDWTPDSTHLICAFA
NTPKYSQVLGLGGRIVRKEWVLDCYRMRRRLPSRRYLMAGPDSSSEDEVASPSGSSGDEA
PSLPRKCPQTKVKPPLAAGSSSPQKPPSPKEIKAASVGPQENSDTEEQSAGRDNGAEESG
DTEDELRRVAEQREHRLPPGQEENGEDPYAGSTDENTDNEGHPELPEEPIPELPDFFQGK
HFFLYGEFPGDERRKLIRYVTAFNGELEDYMSDRVQFVITAQEWDSSFEEALMDNPSLAF
VRPRWIYSCNEKQKLLPHQLYGVVPQA
Download sequence
Identical sequences G5AZN8
HGL_H00000262887 XP_004873144.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]