SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B2B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B2B0
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000105
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000918
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 731-858
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000129
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000578
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000014
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 337-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000485
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000667
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 708-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  G5B2B0
Domain Number - Region: 855-911
Classification Level Classification E-value
Superfamily FnI-like domain 0.000377
Family VWC domain 0.037
Further Details:      
 
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 263-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0524
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5B2B0
Sequence length 1218
Comment (tr|G5B2B0|G5B2B0_HETGA) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_07255 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MRSPRARGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNANGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRSNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQALKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKVPGNCRCQYGWQGLYCDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNGGSCKETSLGFEC
ECSLGWTGPTCSTNIDDCSPNNCSHGGTCQDMVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCQDLVNGYRCICPPGYA
GDHCERDINECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDVDYCEPNPCQNGALC
YNRASDYFCKCPQDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCYNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPSPCHNGGTCVVNGESFTCVCKEGWEGLICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAAGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGKPCITMGSVIPDGIKWDDDCNTCQCQNGRISCSKVWCGPR
PCLLHRGHSECPGGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISTED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCVRKRRKPSSHTLSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPVYTLVDREEKPPNSTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences G5B2B0
HGL_H00000254958 XP_004840881.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]