SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B370 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B370
Domain Number 1 Region: 81-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.46e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5B370
Sequence length 224
Comment (tr|G5B370|G5B370_HETGA) Myogenin {ECO:0000313|EMBL:EHB03731.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_12849 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELGLSPETRGPLEDKGLGIPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIPYIERLQALLSSLNQEERDLRYGGGGGPQPAVPSECSSHSASCSPEWGSALEFS
PNPSDHLLASDPTDAHNLHSLTSIVDSITVEDVSVAFPDETIPN
Download sequence
Identical sequences G5B370
HGL_H00000241651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]