SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B3J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B3J1
Domain Number 1 Region: 8-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.34e-55
Family GDI-like N domain 0.000000000988
Further Details:      
 
Domain Number 2 Region: 374-419
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000122
Family GDI-like N domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5B3J1
Sequence length 430
Comment (tr|G5B3J1|G5B3J1_HETGA) Rab GDP dissociation inhibitor {ECO:0000256|RuleBase:RU363124} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_02321 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
ECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKLPGVPPASMGRGRDWNVD
LIPKFLMANGQLVKMLLYTEVTRYMDFKVIEGSFVYKGGKIYKVPSTEAEALASSLMGLF
EKRRFRKFLVYVANFDEKDPRTFEGADPKKTTMRDLYKKFDLGQDVIDFTGHSLALYRTD
DYLDQPCCETIDRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPI
EEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDAN
SCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEP
IEQKFVSISDLLVPRDLGTDSQIFISRAYDATTHFETTCDDIKDIYKRMTGSEFDFEEMK
RKKNDIYGED
Download sequence
Identical sequences G5B3J1
HGL_H00000369474-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]