SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B5W3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B5W3
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.22e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000429
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.44e-61
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000158
Further Details:      
 
Domain Number 3 Region: 597-760
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-39
Family AlaX-like 0.041
Further Details:      
 
Domain Number 4 Region: 515-593
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000000226
Family AlaX-M N-terminal domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5B5W3
Sequence length 983
Comment (tr|G5B5W3|G5B5W3_HETGA) Alanyl-tRNA synthetase, cytoplasmic {ECO:0000313|EMBL:EHB04674.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15460 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MNSTLTASEIRERFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPS
HPLAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKESACKMALE
LLTQEFGIPVDRLYVTYFGGDEAAGLEPDLECKQIWQTLGLDDSRILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDASYLVNQDDPNVLEIWNLVFIQYNRETDGTLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDADGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYGF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRARGLEA
TDDSPKYNYHSDSSGGYLFESAVATVLALRREKMFVEEVSTGQECGVLLDKTCFYAEQGG
QIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTIYGNLKVGDQVRLFIDEPRRRP
IMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEETGNEMI
KAAKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPSGPAGSLTSV
EFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLKKSFSTMESK
VKAQTAPNKDVQREIVDLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKANVQKR
VLERTKQLIDSNPNQPLVILEMESGASAKATRGWGPGTTLPVTDALNEALKLFKTHSPET
SAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNV
GCLQEALQLATSFAQLHLGDVKN
Download sequence
Identical sequences G5B5W3
HGL_H00000392379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]