SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B5Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B5Y7
Domain Number 1 Region: 352-464
Classification Level Classification E-value
Superfamily eIF1-like 3.4e-33
Family eIF1-like 0.000001
Further Details:      
 
Domain Number 2 Region: 131-188
Classification Level Classification E-value
Superfamily Homeodomain-like 2.21e-16
Family Myb/SANT domain 0.00013
Further Details:      
 
Weak hits

Sequence:  G5B5Y7
Domain Number - Region: 36-99
Classification Level Classification E-value
Superfamily BRCT domain 0.0497
Family DNA-repair protein XRCC1 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5B5Y7
Sequence length 464
Comment (tr|G5B5Y7|G5B5Y7_HETGA) Telomeric repeat-binding factor 2-interacting protein 1 {ECO:0000313|EMBL:EHB04698.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15484 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAEALDMGKDPNGPTHSSTLFVRGDGNPLSFYVRPSPIKRRLSTLILHGGGTVWVQEPGA
VLLAQPGEALAEASGDFISTQYILDCVERNERLELEAYRLGAALAGVRALETKPGASGEG
AAESEPQPPTGRVAFTDADDVAILTYVKEHARSPSSVTGNALWKAMEKGALTQHSWQSMK
DRYLKHLRGQEHKYLLGDAPRRQYVDSDGPLKQGLRLSQTPEEIAANLTVRIWLCQHSAC
SPLPGRTPAIRKPQNKRTPDLPEEECGKEESGENETVKKILVESTRDFEEVVVNESSDFE
IHITMCDDDPPTPEDSETQPDEEEEEKLSSPEVGAAIKIIQPFPPRKRNCIVCPTIQNFH
SFDPFADASKADDLLPASTEDYIHIRIQRNDRKTLTTVQGIADDYDKKKLVKAFKKKFAC
DGTVIEHPEYGEVIQLQGDQRKNICQFLVVIGLAKDDQLKVHGF
Download sequence
Identical sequences G5B5Y7
HGL_H00000300086-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]