SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B6F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B6F4
Domain Number 1 Region: 29-216
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.19e-52
Family Tpt1/KptA 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5B6F4
Sequence length 252
Comment (tr|G5B6F4|G5B6F4_HETGA) tRNA 2'-phosphotransferase 1 isoform 1 {ECO:0000313|EMBL:JAN99546.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_20683 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSSSGGRSREAAGPKGRRASRPRQQDRDVQLSKALSYTLRHGALKLGLPMGADGFVPLHS
LLQLPQFHSFSAEDVQHVVDTNEKQRFTLRPGDPSTGPLIRANQGHSLQVPDLELVPLET
PQALPRMLVHGTFWKHWPSILLKGLSCQGRTHIHLAPGLPGDPGIISGMRRNCEVAVLIN
GPLALADGIPFFCSANGVILTPGDADGFLLPKYFKEALQLCPARKPLSLPGDKETECPSG
PKHSPRGRMIKQ
Download sequence
Identical sequences G5B6F4
HGL_H00000314073 XP_004852593.1.39548 XP_004852594.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]