SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B758 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B758
Domain Number 1 Region: 474-679
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.87e-48
Family ATP-dependent DNA ligase catalytic domain 0.00023
Further Details:      
 
Domain Number 2 Region: 689-832
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-36
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00018
Further Details:      
 
Domain Number 3 Region: 90-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.71e-30
Family PARP-type zinc finger 0.00000119
Further Details:      
 
Domain Number 4 Region: 933-1011
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000771
Family DNA ligase 0.000054
Further Details:      
 
Domain Number 5 Region: 258-498
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0000000017
Family ATP-dependent DNA ligase DNA-binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5B758
Sequence length 1013
Comment (tr|G5B758|G5B758_HETGA) DNA ligase {ECO:0000256|RuleBase:RU000617} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18280 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MTLTFKILFSRNLQALGRKELCSFREQSHWSGIRQLSSWSRTDLLHGHFLLQRRKPILPL
QGGHLRPQATCFIFLPGSHVGLCSGPCEMAEQRFCVDYAKRGTAGCKKCKEKIVKGICRI
GKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTELEGWEELEDSEKEQITQ
HIADLSSKAASTPKKKAVVQAKLTAAGQVTSPVKGSSFVTSTNPRKFSGFSAKPNNSEQA
PSSPAPKTSLSSSKCDPKHKDCLLREFRKLCAMVADNPSYNSKTQIIQDFLRKGSAGDGF
HGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNADDMARDLEQGDVSETIRVFFE
QSKSFPPAAKSLLTIQEVDEFLLQLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHD
LKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERILQNEQEVKKEPGRKRALSVQASLMT
PVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQVHKNGDHFSYFSRSLKPVLPHKVA
HFKDYIPQAFPGGHSMILDSEVLLIDNKTGKPLPFGTLGVHKKAAFQDANVCLFVFDCVY
FNDVSLMDRPLCERRKFLHDNMVEIPNRIMFSEMKQVTKASDLADMINQVIREGLEGLVL
KDVKGTYEPGKRHWLKVKKDYLNEGAMADTADLVVLGAFYGQGSKGGMMSIFLMGCYDPG
SQKWCTVTKCAGGHDDATLTRLQKELDMVKISKDPSKIPSWLKINKIYYPDFIVPDPKKA
AVWEITGAEFSKSEAHTADGISIRFPRCTRIRDDKDWKSATNLPQLKELYQLSKEKADFT
IVAGDEGGSTTGGSSGENEGTSGTAVSHKAPRASPKPSASARKAEGKLSNPNSKDSNKLN
AKPSPVKLGEKLALKSSPVKVGEKRKAADDSPCHAKVLLDIFTGVRLYLPPSTPDFGHLR
RYFVAFDGDLVQEFDVASATHVLGNRDKNPEAQLVSPEWIWACIRKQRLVAPC
Download sequence
Identical sequences G5B758
HGL_H00000367787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]