SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5B7H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B7H2
Domain Number 1 Region: 41-216
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.06e-45
Family DnaQ-like 3'-5' exonuclease 0.00000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5B7H2
Sequence length 237
Comment (tr|G5B7H2|G5B7H2_HETGA) Oligoribonuclease, mitochondrial {ECO:0000313|EMBL:EHB05233.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_04190 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MPGGCLGSRLLRGVGGSGGQVWARGVREGGAVMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQA
EYEFLSFVRQQTPPGLCPLAGNSVHADKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWY
PEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGENEKTVS
Download sequence
Identical sequences G5B7H2
HGL_H00000265881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]