SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5B8X1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5B8X1
Domain Number 1 Region: 48-158
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-30
Family Ribonuclease PH domain 1-like 0.00033
Further Details:      
 
Domain Number 2 Region: 258-361
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-25
Family Ribonuclease PH domain 1-like 0.00018
Further Details:      
 
Domain Number 3 Region: 159-247
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.11e-23
Family Ribonuclease PH domain 2-like 0.0022
Further Details:      
 
Domain Number 4 Region: 401-492
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 5 Region: 480-544
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000515
Family Cold shock DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5B8X1
Sequence length 576
Comment (tr|G5B8X1|G5B8X1_HETGA) Polyribonucleotide nucleotidyltransferase 1, mitochondrial {ECO:0000313|EMBL:EHB05732.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15266 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAACRQCCSCLRLRPLGDGPLRLSERNLALAHLQVRALWSGTRSRAVSVDLGNRKLEISS
GKLARFADGSAVVQVDYRQKAAAAGRIPTNYLRREIGSSDREILTSRIIDRSIRPLFPAG
YFYDTQVLCNLLAVDGINEPDVLAINGASVALSLSDIPWNGPVGAVRIGMIGGECIVNPT
RKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQDFCHAIKVGVKYTQQIIQGIQQLVKE
IGVAKRTPQKIFTPLPDIVKHAHNGIKDKNFMLHYEFPPYATNETGKVTGINRRELGHGA
LADKALYPVIPKDFPFTIRVTSEVLESNGSSSMASACGGSLALMDAGVPVSSAVAGVAIG
LITKINPEKGEIEDYRLLTDILASIFPVAKREILQIMNKTISKPRGSRKENGPVVETVEI
PLSKRAKFVGPGGYHLKRLQAETGVTISQVDEETYSVFAPTPSAMHEAREFITEICKDDQ
EYQLEFGAVYTATITEIRDSGVMVKLYPNMTAVLLHNTQLDQRKVKYFGRDPADGRMRLS
RKVLQSPATSLVKTLSDRNSVMMRESISQSSSNSSG
Download sequence
Identical sequences G5B8X1
HGL_H00000400646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]