SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BAW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BAW5
Domain Number 1 Region: 27-256
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.14e-28
Family FAD-linked reductases, N-terminal domain 0.051
Further Details:      
 
Weak hits

Sequence:  G5BAW5
Domain Number - Region: 386-472
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.0916
Family DsrA/DsrB N-terminal-domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BAW5
Sequence length 678
Comment (tr|G5BAW5|G5BAW5_HETGA) FAD-dependent oxidoreductase domain-containing protein 2 {ECO:0000313|EMBL:EHB06426.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_03687 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MGLSAALWGPLGLLLSLALPPAVGAHTHRDYCVLGAGPAGLQVAAFLHHAGRDYEVFERT
PAPGSFFMRYPRHRKLISINKRYTGKNNAEFNLRHDWNSLLSHDPRLVFRRYSRAYFPDA
GDMVRYLRDFADRLGLHVRYNTNIVHVTLKKDWQAWNSHYFILTNQKGQVYQCSVLLVAT
GLSVPNLVDFPGSEYAEGYESVSVDPEDFVGQNVLILGRGNSAFETAENILGVTNFIHML
SRSRVRLSWATHYVGDLRAINNGLLDTYQLKSLDGLLESDLRDLAIVKDAKGKFHITLGF
FLEETNASRSADAIPLPQDDNDNFAMRVAYDRVIRCLGWKFDFSIFNQSLRLSSGSEFSK
KYPLIRASYESKGTRGLFILGTASHSVDYRKSAGGFIHGFRYTVRAVHRLLEHRHHGIPW
PCTEHPTTQLTNSIIRRVNEASGLYQMFGVLADVIXNATAFEYLEEFPMQMLAQLETLTG
RTAKHGLFIINMEYGKNFSGPDKDVFFHDRSVGHTEDAWQSNFLHPVIYYYRHLPTEQEV
RFRPAHWPLPRPTAIHHIVEDFLTDWTAPVGHILPLRRFLENCLDTDLRSFYAESCFLFT
LTRQKLPPFCQQGYLRKQGLVYTKSLQQHGVESGLLRDYATMGQVLEDSSRQPGDQEPVN
QPLGTGHLIHLDSNKEEL
Download sequence
Identical sequences G5BAW5
HGL_H00000380401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]