SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BB84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BB84
Domain Number 1 Region: 383-489
Classification Level Classification E-value
Superfamily Homeodomain-like 9.86e-37
Family SWIRM domain 0.0000739
Further Details:      
 
Domain Number 2 Region: 100-155,195-230
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000605
Family DNA topoisomerase II binding protein 1, TopBP1 0.076
Further Details:      
 
Domain Number 3 Region: 561-612
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000434
Family Homeodomain 0.07
Further Details:      
 
Weak hits

Sequence:  G5BB84
Domain Number - Region: 159-199
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0114
Family Chromo domain 0.052
Further Details:      
 
Domain Number - Region: 1101-1139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0493
Family GHMP Kinase, N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BB84
Sequence length 1176
Comment (tr|G5BB84|G5BB84_HETGA) SWI/SNF complex subunit SMARCC2 {ECO:0000313|EMBL:EHB06545.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15763 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
YIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAA
YKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRPNIFLCPDIEPKLLGKLK
DIVKRHQGTVTEDKNNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIP
ASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTL
TDEVNSPDSDRRDKKGGNYKKRKCSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQE
DLTKDMDEPSPVPNVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDE
SSTGNKGEQTKNPDLHEDNVTEQTHHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSK
TPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAE
SRPTPMGPPPTSHFHVLADTPSGLVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGL
RTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECIL
HFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSAL
EEFSKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGTD
EARAEGQAADEKKEPKEPREGGGVVEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDP
IVDPEKEKEPKEGQEEMLKEVVESEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLA
AVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREREALEYQRQQLLADRQAFHME
QLKYAEMRARQQHFQQMHQQQQQPPPTLPPGSQPIPPTGASGPPTVHGLAVAPASVASAP
AGSGAPPGSLCPSEQIGQAGPTAGPQQPQPAGALQPGGVPPGIPPPGPHGPSPFPSQQTP
PSMMPGAVPGSGHPGVAGNAPLGLPFGMPPPPPPAPSIIPFGSLADSISINLPPPPNLHG
HHHHLPFAPGTLPPPNLPVSMANPLHPNLPTTTTMPSSLPLGPGLGSAAAQSPAIVAAVQ
GNLLPSASPLPDPGTPLPPDPTAPSPGTVTPVPPPQ
Download sequence
Identical sequences G5BB84
HGL_H00000267064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]