SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BC19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BC19
Domain Number 1 Region: 5-73
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 317-394
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-20
Family SH3-domain 0.00086
Further Details:      
 
Domain Number 3 Region: 675-761
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-17
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 69-133
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BC19
Sequence length 762
Comment (tr|G5BC19|G5BC19_HETGA) Putative E3 ubiquitin-protein ligase SH3RF1 {ECO:0000313|EMBL:EHB06830.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14211 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MIPQQGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIHGFFPTN
FVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEGMLADKI
GIFPISYVEFNSAAKQLIEWDKPPMPGVDAGECTSATAQSNTAPKHSDTKKNTKKRHSFT
SLTMANKSSQASQHRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHISTTGLIV
TPPPSSPVTTGPSFTFPSDVPYQAALGTMNPPLPPPPLLAATVLATTPPGATAAATAATG
MGPRPVAGSTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQDGWFKG
TSMHTSKIGVFPGNYVAPVTRAVTNASQAKVSMSTAGQTSRGVTMVSPSTAGGPAQKLQG
NGVAGSPSVVPTAVVSAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHSQERPTAAV
TPIQVQNAACLGPPSMGLPHHSLGSPQPLAPMAGSAAHVAAVTIGRASAPLACAPAASVT
SASITTASLESEPSGRAVTGLSGLPTSPDSASSACGNSSAAKQDKDSKKEKKGLLKLLSG
ASTKRKLRVSPPASPTLEVELGASELPLQGAVGPELPLGGGHGRAGSCPMDPDGPVQAMA
SAALAQDAFHRKTSSLDSAVPIAPPPRQACSSLGPVVNESRPVVCERHRVVVSYPPQSEA
ELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Download sequence
Identical sequences G5BC19
HGL_H00000284637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]