SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BC27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BC27
Domain Number 1 Region: 71-291
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.68e-34
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000134
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000672
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BC27
Sequence length 313
Comment (tr|G5BC27|G5BC27_HETGA) Thioredoxin reductase 3 {ECO:0000313|EMBL:EHB06838.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_09826 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
EELRRRLRGLMEDSRVMIFSKRCYDGASIQEMLLEITNQKTVPNIFVNKVHVGGCDQTFQ
AHHSGLLQKLLQEDSACDYDLIVIGGGSSGLSCAKVWAQGLGGTCVNMGCIPKKLMHQAA
LLGQALRDSRKFGWEYSQQVKHNWEIITEAIQNHIGSLNWGYRLSLREKGVIYINSCGEF
VGQHKLKVQQLEKGSPGKLKVSAKSTEGAETTEDVYNTVLLAVGRDSCTRHIGLEKIGVS
INERNGKIPVDVEQTNVPHIYAIGDVLEGKPELTPVAIQGGKLLARRLFGASLEKVGLHE
PQSHSLRAMSILS
Download sequence
Identical sequences G5BC27
HGL_H00000413404-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]