SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BC62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BC62
Domain Number 1 Region: 11-74
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000249
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BC62
Sequence length 76
Comment (tr|G5BC62|G5BC62_HETGA) Rho GTPase-activating protein 12 {ECO:0000313|EMBL:EHB06873.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_11557 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKMADRSRKTVPGQVYIEVEYDYEYEAKDRKVVIKQGERYILVKKTNDGWWQVKPDENAK
AFYVPAQYVKELTSET
Download sequence
Identical sequences G5BC62
HGL_N10019758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]