SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BCK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BCK0
Domain Number 1 Region: 536-561,603-683
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-16
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BCK0
Sequence length 697
Comment (tr|G5BCK0|G5BCK0_HETGA) Solute carrier family 26 member 1 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_18968 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MESSPEAPQQGKGLVLVRRQPPKPRGRMETLKARLQQSCRCSVPRAWGLVQDLIPATRWL
RQYRPQEYLAGDIMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLLGTSHH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSRDGNSSTVNSSVAMLEPGLQDCGRDCYAIRV
ATALTLMTGIYQVLMGIFRLGFMSTYLSQPLLDGFAMGASVTILTSQLRHLLGVRVPQHQ
GLSMVVRTWLSLLRGLGQANVCDVVTSAVCLSVLLAARELSDRCRHRMKVPLPTELLVIV
VATLVSHFGQLHSRFGSSVAGHIPTGFVPPQAPDLELMWRVALDAVSLALVGSAFSISLA
EMFARSHSYSVRANQELLAVGCCNVLPAFFHCFVTSAALSKTLVKTATGCRTQVSSVVSA
AVVLLVLLALAPLFRDLQRCVLACVIVASLRGALRKVRDLPQLWRLSPADALVWAATAAT
CVLLSVEAGLLAGLLLSLLSLVGRTQRPRAALLARIGDSAFYEDAAEFEGLVPPAGVRVF
RFSGPLCYANKAFFLQSLYSLTGLDAGRLAARRKGQGSELEAGEGDRMEGRDPGSSQARL
VPMVAGFHSVVIDCASLLFLDMAGMAVLQDLRRDYRALGVSLLLACCSPSVRDTLHRGGF
LGEEQEAENKQLFPSVHSAVEAAQAHYGQLVATDSAL
Download sequence
Identical sequences G5BCK0
HGL_H00000354721 XP_004847515.1.39548 XP_004847516.1.39548 XP_004847517.1.39548 XP_004847518.1.39548 XP_012928534.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]