SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BDK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BDK7
Domain Number 1 Region: 286-417
Classification Level Classification E-value
Superfamily C-type lectin-like 1.07e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 145-278
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-37
Family C-type lectin domain 0.00044
Further Details:      
 
Domain Number 3 Region: 737-863
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-34
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 4 Region: 427-563
Classification Level Classification E-value
Superfamily C-type lectin-like 9.96e-34
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 5 Region: 874-1021
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-33
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 6 Region: 571-721
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-28
Family C-type lectin domain 0.00052
Further Details:      
 
Domain Number 7 Region: 1167-1306
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-27
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 1038-1161
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-24
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 82-140
Classification Level Classification E-value
Superfamily Kringle-like 1.48e-20
Family Fibronectin type II module 0.00079
Further Details:      
 
Domain Number 10 Region: 2-82
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000258
Family Cysteine rich domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BDK7
Sequence length 1390
Comment (tr|G5BDK7|G5BDK7_HETGA) C-type mannose receptor 2 {ECO:0000313|EMBL:EHB07368.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_17470 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MQCLGTGWPGANTTTSLGMYECDREALSLRWHCRTLGDQLSLLLGGRAGNTSKSGALERG
DQTRSGQWHIYGSEEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGH
LWCATTQDYGKDERWGFCPIKSTDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQG
ADLLSITEIYEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNP
SEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQ
GHCYRLQAEKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQ
MNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQL
SQGATEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTNHGSQLVTITNRFEQAFVSS
LIYNWEGEYFWTALQDLNSTSSFRWLSGDEVMYTHWNRDQPGYSHGGCVALATGSAMGLW
EVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDPKLRHCYKVFSSER
LQDKKSWIQAQGACRELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNR
RDPRVGQSWRWSDGLGFSYHNFDRSRHDDDDIRGCTVLDLASLQWVAMQCETQLDWICKI
PRGADVQEPDVSPQGRREWLHFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELD
FLGHNLQKFSQGQEQHWWIGLHTSENDGRFRWTDGSIINFISWAPGRPRPISKDQKCVYM
TASQEDWADQRCMTALPYICKRSNSTGEMQSPDLPAAALGGCPTGWNQFLNKCFRIQGED
PQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQ
EPLLYTNWAPGEPSGPSPAPSSNKPTSCAVVLHSPAAHFTGRWDDRSCMEETHGFICQKG
TDPTLSPSPAASPPAPGAELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPGPYTQA
FLTQAARGLRVPLWIGLASEEGSRRYSWVSEEPLSYVSWRDGEPQQAGGCAYVDVDGAWR
TTSCDTKLQGAVCGVSRGPPPPRRMSYHGSCPQGLADSAWIPFRKHCYSFHTELLLGHQE
ALQRCQRAGGTVLSILDEMENVFVWEHLQDSEGQNRGAWLGMNFSPKGGVLVWQDNTAVN
YSNWGPPGLGPSMLSHNSCYWIQSSNGLWRPGACTNVTMGVVCKLPRVAESSFSPSAALP
ENPAALVVVLMAVLLLLALLTAALILYRRRQSVERGTFEGARYSRSSSSPGEATEKNILV
SDMEMNEQQE
Download sequence
Identical sequences G5BDK7
HGL_H00000307513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]