SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BDR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BDR4
Domain Number 1 Region: 3-220
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-55
Family GHMP Kinase, N-terminal domain 0.0000000126
Further Details:      
 
Domain Number 2 Region: 227-384
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.88e-40
Family Mevalonate kinase 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BDR4
Sequence length 396
Comment (tr|G5BDR4|G5BDR4_HETGA) Mevalonate kinase {ECO:0000256|RuleBase:RU363087} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_12563 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLSGVLVVSAPGKVILHGEHAVVHGKVALAVALNLRTFLRLEPHSNGKVTLNLPNICTKQ
TWDVTSLQLLDTSFLDQGDIPAPTAEQVEKLKEVAGVPQNRAVPEHLAVLAFLYLYLAIC
RKQRALPSLDITVWSELPPGAGLGSSAAYSVCLAATLLTMCEDISNPLKDGDSVSRWPKE
DLELINQWAFRGERVIHGNPSGVDNAISTWGGALRYQQGKISSLNSPPALQILLTNTKVP
RSTKALVAGVRNRLIKFPEIVSPVLTSIDAISRECERVLGEMAAAPALEQYLILEELIDM
NQYLLNALGVGHTSLDQLCQVAGAHGLHSKLTGAGGGGCGITLLRPDLERAEVEAAKQAL
TGCGFNCWETSVGAPGVSIHLATSLHGPISQALGVL
Download sequence
Identical sequences G5BDR4
HGL_H00000376487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]