SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BDS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BDS3
Domain Number 1 Region: 978-1178
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-27
Family Reverse transcriptase 0.002
Further Details:      
 
Domain Number 2 Region: 1522-1614
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000127
Family Retroviral integrase, catalytic domain 0.021
Further Details:      
 
Domain Number 3 Region: 1235-1364
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000119
Family Ribonuclease H 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BDS3
Sequence length 1812
Comment (tr|G5BDS3|G5BDS3_HETGA) Integrase catalytic domain-containing protein KIAA1305 {ECO:0000313|EMBL:EHB07434.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_16490 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MLHCAFLGAQGLFLDCLCWSTLAYLVPGPPGSLMVGGLTESFTMTQNWLEELVARLRWGP
APLLTPRGIWEAEVTRAFGALVWIRGDQYAGDLLQLPPAVQELLLSLVRDAAGKEDIIEW
LSHFGISNTCSPVALRSPPQQQKEDSAMVSTGESPGSFLEMGTLQNGGPENPKRLSSLGA
TRSLIPAQSTQQETANQVVRVGSNNQSGTDSDREEGLVRATSSQDSVNHTPALLQQKQVQ
KVEEKFPFQPPVSALGVYPSWKAWAPGPAFGPLWPGTIAAAFWRINQLHSLHLAWLLSQA
CFSLPFWQRPLGPIQLKLPGQSALPLNLEWKQKELAPLPSAESPACRPDGELVYKSTETT
LQNCPRPETPPKVMSLLVVPGGSGEKDKVSPRLPLLASTTQLQAGGERRNQGSLQPDCMW
LEKGPYPASPTEQGVLTAQGRPMAQGGLTAQSAPEAGTVPETLKVPMAAVVPKAENPPLT
QGQPAAPKVPTSQMMPAVSTEPAAPKVPLAPTMPTAQVVSTAQKAAVDQPALASAAQVMS
TTPKTAMAQKMLATKTSPASPKTLKAQTGPVTKMESAAPKASAAPKTSAAPKAPAASKAS
RAPQTPAVQKVPTGTGPTLDVARLLSEVQPSSKGDASLPKGQVEPGRQGVQSSSKHQLLG
GWEGGPRQSPRHPQVNSTVTSFQRYHEALNTPFELNLSGEPGNQELRRVVIDGSSVAMVH
GLQHFFSCRGIAMAVQYFWNRGHREVTVFVPTWQLKKNRRVRESHFLTKLHSLKMLSITP
SQLENGKKIATYDYRFMVKLAEETDGVIVTNEQIHTLMNNSKKLMVKDRLLPFTFAGNLF
MVPDDPLGRDGPTLDEFLKKPNRLDTDIGNFLKVWKTLPPSSASISQLRDDTDPRPLEGP
QNVEEVREEKEERQDEEWREGQGMPGWAEEDDLDSFLASVFRVECPSLSEEILQCLSLHD
PPDGALDIDLLPGVASSYLGIPWDGKAPCQQVLAQLAQLTTPSNFTVLSFFVGFMDSHRD
VIPDYEALMGPLHSLLKQKPDWVWDQEHEKAFLALKRALVSALCLSAPNCQLPFRLQVTV
SQVALTAILYQEHSGKKHPIAYTSKPLLPDEDSEGPQSGGDSPYAVAWALKHFSHCIGDD
PVVLHLVYASRTTVAPEAPECCRVSKAWLIRWSLLVQDRGKRALELALLQGLLGENRLLT
PVSSMPRFFQVLPPFSDLSTFVCIHMSGYCFYREDEWCAGFGLYVLSPTSPPVSLSFSCS
PYTPTYAHLAAVACGLERCGQSHLPVVFLTHCNWIFSLLWELLPLWRARGFLSSDGAALP
HPSLLSYIISLTSGLSSLPFIYRTSYRSSLFAVTVDNLAKQGAQGSGQWWDLPKDVPVPV
VTSHTMGKRPNLLALQLSDSTLADIIAKLRAGQKLSVSSPFSSAFHSLSLDKESGLLMFK
GDKKPKVWVVPRQLRRDLIFSVHDIPMGAHQRPEETYKKLQLLGWWPGMQEHVKDYCRSC
LFCIPRNLTGSELKVIESPWPLRSTAPWSNLQIEVVGPLTVSEEGHRHVLIVADPNTRWV
EAFPLKPYTHMAVAQVLLQHVFARWGVPVRLEAAQGPQFARHVLVSCGLALGAQVTSLSR
DLQFPCLVSSEAYWEFKRALKEFIFLHGRKWAASLPLLHLAFRASSTEATPFQVLTGAER
RLTEPLWWEMSSANIEGLKMDVFLLQLIGELLELHWRGAEKGTEKADNRRFKQESQEKEW
NVGDQVLLLSLPRNGSSAKWVGPFYIGDRLSLSLYRVWGFPTPEKLGCIYPSSLMKPFAK
SGTPLSFKVLEQ
Download sequence
Identical sequences G5BDS3
HGL_H00000371994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]