SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BEU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BEU5
Domain Number 1 Region: 302-508
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.48e-67
Family DNA polymerase beta-like 0.0000000195
Further Details:      
 
Domain Number 2 Region: 149-240
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 1.44e-26
Family DNA polymerase beta, N-terminal domain-like 0.0000199
Further Details:      
 
Domain Number 3 Region: 242-300
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.55e-17
Family DNA polymerase beta-like, second domain 0.0000474
Further Details:      
 
Domain Number 4 Region: 36-120
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000196
Family DNA topoisomerase II binding protein 1, TopBP1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BEU5
Sequence length 509
Comment (tr|G5BEU5|G5BEU5_HETGA) DNA nucleotidylexotransferase {ECO:0000256|PIRNR:PIRNR000817} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_11927 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MDPLQTAHLGPRKKRPRQTGTLMASGPHNIRFGDLVLFILEKKMGTTRRAFLMELARKKG
FRVENELSDSVTHIVAENNSGNDVLEWLQVQNIQASSQLELLDVSWLIECMGAGKPVEMT
GRHQLVVRDSPASPNPGPQKTPSLAVQKIPEYACQRRTTLDNCNYIFTNAFEILAEDCEF
RENEGFYVTYMRAASVLKSLPFTIISMKDTEGIPCLGGRVKCIIEEIIEDGESSEVKAVL
NNERYKSFKLFTSVFGVGLKTSEKWFRMGFRSLSKIRSDKSLTFTRMQKAGFLYYEDLVS
CVTRAEAEAVNMLVKEAVWTFLPGAFISMTGGFRRGKEIGHDVDFLITSPEVTEDEEQQL
LHKVINLWEKKGLLLYSDLVESTFEKLKLPSRKVDALDHFQKCFLILKLHHQRVDNDKSP
QQGGKTWKAIRVDLVMCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT
KKTFLKAESEEEIFTHLGLDYIEPWERNA
Download sequence
Identical sequences G5BEU5
HGL_H00000360216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]