SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BF94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BF94
Domain Number 1 Region: 87-199
Classification Level Classification E-value
Superfamily HSP90 C-terminal domain 1.12e-35
Family HSP90 C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 1-64
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000546
Family Hsp90 middle domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BF94
Sequence length 214
Comment (tr|G5BF94|G5BF94_HETGA) Heat shock protein HSP 90-alpha 1 {ECO:0000313|EMBL:EHB07955.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_15044 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKENQKHIYYITGETKEQVANSAFMERLRKHGLEVIHMIEPINEYCIQQLKEFEGEALGS
VTKEGLELSEDEEEKKKQKEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSK
YGWTANMERIMKVQALRDNSTMGYMTAKKHLEINPDHSITETLRQKAEADKNKSVKDLVI
LLYETALLSSDFSLEDPPDTRQQNLQDDQAGAHY
Download sequence
Identical sequences G5BF94
HGL_H00000369649-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]