SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BHB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BHB2
Domain Number 1 Region: 426-536,570-619
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.01e-31
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BHB2
Sequence length 641
Comment (tr|G5BHB2|G5BHB2_HETGA) Poly [ADP-ribose] polymerase {ECO:0000256|RuleBase:RU362114} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_06054 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MFTRGYSVEDFDIKGQFWNDDDSEGDNESEEFLYGVQGSCAADLYRHPQLDADIEAVKEI
YSENSVSIREYGTIDDVDIDLHINISFLDEEVSTAWKVLRTEPIVLRLRFSLSQYLDGPE
PSIEVFQPSNKEGFGLGLQLKKILGMFTSQQWKHLSNDFLKTQQEKRHSWFKASGTIKKF
RAGLSIFSPIPKSPSFPIIQDSMLKGKLGVPELRVGRLVNRSISCTVKNPKVEVFGYPPS
PQAGLLCPQHAGLPPPARTSPLVSGHCKNIPTLEYGFLVQIMKYAEQRIPTLNEYCVVCD
EQHVFQNGSMLKPAVCTRELCVFSFYTLGVMSGAAEDVATGAEVVDLLVAMCRAALESPR
KSIIFEPYPSVVDPTDPKTLAFNPKKKNYERLQKALDSVMSIREMTQGSYLEIKKQMDKL
DPLAHPLLQWIISSNRSHIVKLPLSRQLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGST
FAFHGSHIENWHSILRNGLVNASYTKLQLHGAAYGKGIYLSPISSISFGYSGMGKGQHRM
PSKDELVQRYNRMNTIPQTRSIQSRFLQSRNLNCIALCEVITSKDLQKHGNIWVCPVSDH
VCTRFFFVYEDGQVGDANINTQDPKIQKEIMRVIGTQVYTN
Download sequence
Identical sequences G5BHB2
HGL_H00000287196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]