SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BIQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BIQ0
Domain Number 1 Region: 319-408
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.52e-20
Family Canonical RBD 0.0023
Further Details:      
 
Domain Number 2 Region: 16-53
Classification Level Classification E-value
Superfamily SAP domain 0.0000000311
Family SAP domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BIQ0
Sequence length 588
Comment (tr|G5BIQ0|G5BIQ0_HETGA) SAFB-like transcription modulator {ECO:0000313|EMBL:EHB09161.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14944 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAATASTVGSAEGKNIAGLRVIDLKSELKRRNLDINGVKTVLVSRLKHAIEEEGGDPDNI
ELTVSTDTPNKKPTKGKGKKQEADELSGDASVEDDAFVKDCELENQEAHEQDESGEIKDP
EEFGENEEENANSKELLSAEENKRAHELIEAEAKEDAEKEDIESQDIEAQEGEDDTFLTA
QDGEEEENEKDIAGSGDGTQEVSKSLPSEGNLAGADHTAHEEMEANVTVKEAEDDNISVT
VQAEDAITPDFDGDDLLETGKNVKITDSEASKPKDGQDVVAQRPEKETKDYEMNVNHKDD
SKTSSKDDKGSTSSTSGSSGSSTKTIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNAR
SPGAKCYGIVTMSSSTEVSRCIAHLHRSELHGQLISVKKVKGDPSKKEMKKENDEKSSSR
SSGDEKNMNDRSSKTQTSVKKEEKRLSIKSEKKESRDNKKMESKEEKNDNGASGQISESI
KKNEEKKRISSKSPGHTVILDQTKGDHCRPSRRGGYEKIHARSKEKERASLDKKRGKDYR
RKEILPYGKMKEQRLREHLVGFERLRTSNGTSKMKRDCRKRAWRARTN
Download sequence
Identical sequences G5BIQ0
HGL_H00000369887-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]