SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G5BIX5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BIX5
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.2e-44
Family VHS domain 0.00029
Further Details:      
 
Domain Number 2 Region: 178-252
Classification Level Classification E-value
Superfamily SH3-domain 9.06e-22
Family SH3-domain 0.0000594
Further Details:      
 
Weak hits

Sequence:  G5BIX5
Domain Number - Region: 284-353
Classification Level Classification E-value
Superfamily GAT-like domain 0.00497
Family GAT domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BIX5
Sequence length 511
Comment (tr|G5BIX5|G5BIX5_HETGA) Signal transducing adapter molecule 2 {ECO:0000313|EMBL:EHB09236.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_13010 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
EKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPRVALQALTLLGACV
ANCGKIFHLEVCSRNFATEVHAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISATI
KSMKEEGVTFPPANSQTVSASAKNGVSLNKNKEDEDIAKAIELSLQEQKQQCTETKSLYP
SAEIQLNNRVARKVRALYDFEAAEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPS
NFVTTNLNIESEAAAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRALQMLQSIDPADSK
PDSQELLDLEDICQQMGPLIDEKLEEIDRKHSELSELNVKVLEALELYNKLVNEAPVYSV
YSKLHPSAHYPSTSAGAPLQTYPIQSHGGNYMGQSLHQVTATQSYSLGPDHISSLRSLPS
NMNSSVTTQPAQTPYLSTGQDTASNPYMNQNSNLPSATGTTAFTQQMGMSVDMSVYQNTT
CSLPQLAGFPVAVPAPSVAQQQTNYHQQPLL
Download sequence
Identical sequences G5BIX5
HGL_H00000263904-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]