SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BJR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BJR2
Domain Number 1 Region: 28-258
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.73e-69
Family Ecto-ART 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BJR2
Sequence length 326
Comment (tr|G5BJR2|G5BJR2_HETGA) Mono(ADP-ribosyl)transferase {ECO:0000256|RuleBase:RU361228} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19885 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MKTGHFEMVTMLLAAVILMDIFQVKAEILDMADNVFDDEYLKCTDRMEMKYVPQLLKEEK
ANHQLLETVWENAKAKWESQKPQLFLPTKFQDNHGIALMTYISEAKEQTPFYHLFNEAVK
MAGQSRKDYIYGFQFKALHFYLTRALQLLRRPCEDSYKNVVYKTSQDTSFTFGGQNQARL
GNFTLAYSAKPEVANDQHIVLTIYTCFGVDVEKFFGKESERITLIPLSEVFQVSQEKAGN
NLILHSTNKTCSHYECAFVGGLKSENCAENLEYSQPIYVYNPGPGPVPVPGPKTHPSASS
GNMFLPLLGAFIILISTSAVNLFIVR
Download sequence
Identical sequences G5BJR2
HGL_H00000348064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]