SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BPG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BPG8
Domain Number 1 Region: 53-314,413-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.37e-80
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000324
Further Details:      
 
Domain Number 2 Region: 504-665
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.27e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 291-409
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 2.09e-41
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G5BPG8
Sequence length 665
Comment (tr|G5BPG8|G5BPG8_HETGA) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial {ECO:0000256|RuleBase:RU362051} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_14707 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MAGVGTVSRFLRARRLALSRAQWPAAFRAQACGFHFSVNGNKRASAKVSNSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCI
EDGSIHRLRAKNTVVATGGYGRTYFSCTSAHTTTGDGTAMITRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDIVCRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYRG
QVLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESSRPGD
KVPPVKPNAGEESVTNLDKLRFADGSIRTSELRLNMQKTMQNHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLLLCALQTIYGAEARKESRGAHAREDYKV
RIDEFDYSKPIQGQQKRPFGEHWRKHTLSYVDIKTGKVTLEYRPVIDKTLNEADCSTVPP
AIRSY
Download sequence
Identical sequences G5BPG8
HGL_H00000264932 XP_004845158.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]