SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BPQ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BPQ1
Domain Number 1 Region: 252-531
Classification Level Classification E-value
Superfamily SPOC domain-like 1.31e-84
Family Ku70 subunit middle domain 0.000000000627
Further Details:      
 
Domain Number 2 Region: 32-251
Classification Level Classification E-value
Superfamily vWA-like 1.7e-61
Family Ku70 subunit N-terminal domain 0.00000000852
Further Details:      
 
Domain Number 3 Region: 558-605
Classification Level Classification E-value
Superfamily SAP domain 0.000000000208
Family SAP domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G5BPQ1
Sequence length 608
Comment (tr|G5BPQ1|G5BPQ1_HETGA) ATP-dependent DNA helicase 2 subunit 1 {ECO:0000313|EMBL:EHB11262.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_19439 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSGWESYYKAEGDEEEEEEESPDVGGEYKYSGRDSLIFLVDVSRPMFESQGENELTPFDM
SIQCIESVYTSKIISSDRDFLGVVFYGTKKDKNSVNFKNIYVLQELDNPGAKRVLELDQF
KGQQGQNHFQDLIGHGCDYSLSEVLWVCANLFSDVQVKMSHKRIMLFTNDDDPHGSDSAK
ASRARTKASDLRDTGIFLDLMHLKKHGGFDISLFYRDIISVEEDADLGVHFEESSRLEDL
LRKVRAKETRKRVLSRLKFKLDRDTALTVGIYNLVQKASKPPPVRLYRETNEPVKTKTRT
FNVNTGSLLLPSDTKRSQIYGNRKIVLEKEETEQLKRFDEPGLVLIGFKPLALLKKHHYL
RPSLFMYPEESLVNGSSTLFSALLIKCLEKEVIALCRYTPRKSTPPYFVALVPQEEELDD
QKIQVTPPGFQLVFLPYADDKRNVPAPEKVMANPEQIDKMKAIVQKLRFKYRSDSFENPV
LQQHFRNLEALALDLMEPEQAVDLTLPKVEAMHKRLGSLVDEFKDLVYPPDYNPEGKATK
RKQDGESSGSKRPNVELSKEELKVHATKGTLGKLTVPMLKEACRVCGLRGGLKKQELVDA
LTQHFLKD
Download sequence
Identical sequences G5BPQ1
HGL_H00000352257-2 XP_004845565.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]