SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G5BQB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G5BQB1
Domain Number 1 Region: 346-445
Classification Level Classification E-value
Superfamily BRCT domain 9.29e-26
Family DNA topoisomerase II binding protein 1, TopBP1 0.0000037
Further Details:      
 
Domain Number 2 Region: 199-300
Classification Level Classification E-value
Superfamily BRCT domain 6.67e-24
Family DNA topoisomerase II binding protein 1, TopBP1 0.025
Further Details:      
 
Domain Number 3 Region: 60-180
Classification Level Classification E-value
Superfamily BRCT domain 1.31e-22
Family DNA topoisomerase II binding protein 1, TopBP1 0.086
Further Details:      
 
Domain Number 4 Region: 912-1014
Classification Level Classification E-value
Superfamily BRCT domain 1.31e-21
Family DNA topoisomerase II binding protein 1, TopBP1 0.029
Further Details:      
 
Domain Number 5 Region: 1271-1373
Classification Level Classification E-value
Superfamily BRCT domain 3.63e-21
Family BRCT domain 0.03
Further Details:      
 
Domain Number 6 Region: 614-745
Classification Level Classification E-value
Superfamily BRCT domain 2.97e-19
Family DNA ligase 0.039
Further Details:      
 
Domain Number 7 Region: 818-871
Classification Level Classification E-value
Superfamily Uteroglobin-like 0.0000136
Family Uteroglobin-like 0.0081
Further Details:      
 
Weak hits

Sequence:  G5BQB1
Domain Number - Region: 545-632
Classification Level Classification E-value
Superfamily BRCT domain 0.0093
Family DNA-repair protein XRCC1 0.082
Further Details:      
 
Domain Number - Region: 1409-1493
Classification Level Classification E-value
Superfamily BRCT domain 0.0245
Family DNA ligase 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G5BQB1
Sequence length 1527
Comment (tr|G5BQB1|G5BQB1_HETGA) DNA topoisomerase 2-binding protein 1 {ECO:0000313|EMBL:EHB11472.1} KW=Complete proteome; Reference proteome OX=10181 OS=Heterocephalus glaber (Naked mole rat). GN=GW7_05108 OC=Hystricomorpha; Bathyergidae; Heterocephalus.
Sequence
MSPNDQEPLLVKFLKCSNNSECFFKALESMKEFQSKEYLQIITEEEALKIKESDRSLYIC
DPFSGAVFDHLKKLSCRIVGPQVVLFCMHYQQCVPRAEHPVYNMVMSNVTVSCTSLDKEK
REEVHKYVQMMGGRVFRDLNISVTHLVAGEVGSKKYLVAANLKKPILLSSWIQTLWEKSQ
ENKITRYTDINMEDFRCPIFLGCVICVTGLGGLDRKAVQQLTIKHGGQYMGQLKMNECTH
LIVQEPKGQKYECAKRWNVHCVTTQWFFDSIEKGFCQDESIYKAEPRPEAKTLPDTSTPT
GQISTTDSRTLSDVSHISNINGSCINESIYSSILNSKLEPTFENLEYLDISAFQAPEDLL
DGCRIYLCGFSGRRLDKLRRLINSGGGVRFNQLNEDVTHIIVGDYDDELKQFWNKSAHRP
HVVGAKWLLECFSKGYMLPEEMYIHASYKPVEIPVSDQPESKTALSKKNSSFSKKDFASS
EMHEQADEDLLSQYVNNNSTVVEANKSEAAESEVGACNDSTHVGPFNNSTHISLQEENQS
SECHCLPDASIITEEALFSRKSFLILGFSNENECNIANIIREYAGKIVSLPSRVVADYAV
VPLLGCEVEATVGEVVTNTWLVTCIDYQTLIDPKSNPLFTPVPVMTGVTPLEDCVISFSQ
CVGAEKDSLIFLASRLGASVQEYFVRKSNAKKGMLASTHLVLKEPVGSKYEAAKKWNLPA
VTIAWLLETARTGKRGDESHFLIENSPTEQRLETKTTNGETLNPGSSAHPGKHVESLRKM
AVTPLDMNRFQSKAFHAVLSQHTGKVPTESPAVGKPLQKEPSVHLDTPSKFLSKDKLFKP
SFDVKDALAALETPGDASKQKKKLSSPLSEVIVRNLKLALENSSRNAVALSASPQLKGTQ
MEKEEAPKPLHKVVVCVSKKLSKKQSELNGIAASLGAEYRWSFDETVTHFIYQGRLNDSN
REYKSVKERGIHIVSEHWLLDCAQEYKHLPESLYPHTYNPKMSLDISAVQDDRLCNGQVL
SAISAVKDSEVDHLTIEENDVDNMTASNKESALPNGSERNDSKGALTQTLEMRENFQKQL
QEIMSATSIVKPQGQRTSLSRSGCNSASSTPESTRSTRSGRSRVLEALRQSRQIVPDVNT
EPSQNEQIIWDDPTAREERARLASNLQWPSCSTQYSEPQADVKKLEDSPFQELLCDSKIA
EKAISDPGNKGGTEAPKHPAFEELETPTKDNHLIPTPQAPSIAFPLANPPVAPHPGEKIV
TIEETHEELKKQYIFQLSSLNPQERIDYCHLIEKLGGLVMEKQCFDPSCTHIIVGHPLRN
EKYLASVAAGKWVLHRSYLEACRTAGHFVQEDDYEWGSSYILDVLTGINVQQRRLALAAM
RWRKKLQQRQESGIVEGAFSGWKVILHVDQSREAGFKRLLQSGGAKVLPGHSLPLFKEAT
HLFSDFNKLKPDDSRVNIAEAAAQNVYCLRTEYIADYLMQESPPPVENYCLPEAVSFLQS
SKEPGPGLSQKRKAPAEKNKIKRSRVH
Download sequence
Identical sequences G5BQB1
HGL_H00000260810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]